Cat#:FPA-8502P;Product Name:Rabbit Anti-Chk2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Chk2 aa 120-160 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: SCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYI ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Chk2 aa 120-160 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: SCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYI