Cat#:FPA-8286P;Product Name:Rabbit Anti-Ceramide synthase 1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal aa 300-349 ( LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR ) of Human LASS1 (NP_067090). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Horse;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal aa 300-349 ( LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR ) of Human LASS1 (NP_067090).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Horse
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.