Cat#:FPA-8208P;Product Name:Rabbit Anti-Centaurin beta 2 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Centaurin beta 2 aa 728-778 (C terminal). The exact sequence is proprietary. (NP_036419.3). Sequence: LARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQK F ;Species Reactivity:Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Centaurin beta 2 aa 728-778 (C terminal). The exact sequence is proprietary. (NP_036419.3). Sequence: LARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQK F
Species Reactivity:
Mouse, Human Predicted to work with: Rat, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
Isotype:
IgG
Application:
IP, WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: