Cat#:FPA-8135P;Product Name:Rabbit Anti-Cell adhesion molecule 4 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Cell adhesion molecule 4 aa 156-205 (internal sequence). The exact sequence is proprietary. (NP_660339). Sequence: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA ;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Cell adhesion molecule 4 aa 156-205 (internal sequence). The exact sequence is proprietary. (NP_660339). Sequence: LRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQA
Species Reactivity:
Human
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 98% PBS, 2% Sucrose
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.