Rabbit Anti-CDKN3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-8034P

• Product Name:
• Rabbit Anti-CDKN3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 67-116 ( LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI ) of Mouse CDKN3 (NP_082498).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cat, Dog, Human

• Isotype:
• IgG

• Application:
• ICC/IF, WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid