Rabbit Anti-CD62E Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-7676P

• Product Name:
• Rabbit Anti-CD62E Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 81-130 (WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDER C) of Human CD62E (NP_000441).

• Species Reactivity:
• Human Predicted to work with: Rat, Sheep, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid