Rabbit Anti-CD33 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-7582P

• Product Name:
• Rabbit Anti-CD33 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human CD33 aa 285-335 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: HRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEM D

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 0.1% BSA, 49% ddH20

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid