Rabbit Anti-CD130 (gp130) Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-7377P

• Product Name:
• Rabbit Anti-CD130 (gp130) Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 158-207 ( FTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKV ) of Human CD130(gp130) isoform 2 (NP_786943).

• Species Reactivity:
• Human Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid