Rabbit Anti-CCDC63 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-7138P

• Product Name:
• Rabbit Anti-CCDC63 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide designed within residues: EDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHD , corresponding to aa 324-373 of human CCDC63 (NP_689804)

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid