Rabbit Anti-Caveolin-1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6886P

• Product Name:
• Rabbit Anti-Caveolin-1 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Caveolin-1 aa 2-34 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAD

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, Flow Cyt

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.