• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Carboxypeptidase B Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-46298P
  • Product Name:
  • Rabbit Anti-Carboxypeptidase B Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Full length native protein (purified) corresponding to Pig Carboxypeptidase B aa 111-416. (Derived from Porcine pancreas). Sequence: TTGHSYEKYNNWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVG KPGPNKPAIFMDCGFHAREWISHAFCQWFVREAVLTYGYESHMTEFLNKL DFYVLPVLNIDGYIYTWTKN
  • Species Reactivity:
  • Pig Predicted to work with: Cow, Dog
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • IgG fraction
  • Storage Procedures:
  • pH: 7.20 Preservative: 0.01% Sodium azide Constituents: 1% BSA, 0.42% Potassium phosphate, 0.87% Sodium chloride BSA is Immunoglobulin and Protease free.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Carboxypeptidase B Polyclonal Antibody-FPA-46297P
  • Online Inquiry

    refresh