Rabbit Anti-Carbonic anhydrase X Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6535P

• Product Name:
• Rabbit Anti-Carbonic anhydrase X Polyclonal Antibody

• Formulation:
• Lyophilised:Add 50 µl of distilled water

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Carbonic anhydrase X aa 116-165 (N terminal). The exact sequence is proprietary. Sequence: NISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHEL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.