Rabbit Anti-Carbonic Anhydrase I Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6511P

• Product Name:
• Rabbit Anti-Carbonic Anhydrase I Polyclonal Antibody

• Formulation:
• Lyophilised:Add 1.0 ml sterile distilled water.

• Host Species:
• Rabbit

• Immunogen:
• Full length native protein (purified) corresponding to Cow Carbonic Anhydrase I aa 2-261. Carbonic anhydrase from Bovine erythrocytes. Sequence: ASPDWGYDGENGPEHWGKLYPIANGNNQSPIDIKTSETKRDPSLKPLSVS YNPATAKEIVNVGHSFHVNFEDSDNRSVLKGGPLSESYRLRQFHFHWGIT DDCGSEHL

• Species Reactivity:
• Cow

• Isotype:
• IgG

• Application:
• ICC, WB, ELISA, Dot blot, IHC-P

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.

• Clonality:
• Polyclonal