Rabbit Anti-CAPRIN2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46293P

• Product Name:
• Rabbit Anti-CAPRIN2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human CAPRIN2 aa 65-114 (N terminal). The exact sequence is proprietary. Sequence: FGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASP Database link: Q6IMN6-5 Run BLAST with Run BLAST with

• Species Reactivity:
• Predicted to work with: Horse, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 2% Sucrose, 98% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid