Rabbit Anti-CaMKII alpha Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6396P

• Product Name:
• Rabbit Anti-CaMKII alpha Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Rat CaMKII alpha aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLS

• Species Reactivity:
• Mouse, Rat Predicted to work with: Chicken, Cow, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.0 Preservative: 0.01% Thimerosal (merthiolate) Constituents: 20% Glycerol, 79% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid