Cat#:FPA-6340P;Product Name:Rabbit Anti-Calponin Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human Calponin aa 240-290 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: TLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHH A ;Species Reactivity:Mouse, Rat, Sheep, Human Predicted to work with: Cow, Pig;Isotype:IgG;Application:ELISA, IHC-Fr, WB, IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide corresponding to Human Calponin aa 240-290 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: TLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHH A
Species Reactivity:
Mouse, Rat, Sheep, Human Predicted to work with: Cow, Pig