• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Calponin Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-6340P
  • Product Name:
  • Rabbit Anti-Calponin Polyclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human Calponin aa 240-290 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). Sequence: TLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHH A
  • Species Reactivity:
  • Mouse, Rat, Sheep, Human Predicted to work with: Cow, Pig
  • Isotype:
  • IgG
  • Application:
  • ELISA, IHC-Fr, WB, IHC-P
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituents: 0.01% BSA, 50% Glycerol
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Pre product:Goat Anti-Calponin Polyclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh