Cat#:FPA-6262P;Product Name:Rabbit Anti-Caldesmon Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Caldesmon aa 500-550. The exact sequence is proprietary. Sequence: THKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESE E ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Guinea pig, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Chinese hamster, Common marmoset, Orangutan;Isotype:IgG;Application:IP, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Caldesmon aa 500-550. The exact sequence is proprietary. Sequence: THKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESE E
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Guinea pig, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Chinese hamster, Common marmoset, Orangutan
Isotype:
IgG
Application:
IP, WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8.
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: