• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-CA7 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-6092P
  • Product Name:
  • Rabbit Anti-CA7 Polyclonal Antibody
  • Formulation:
  • Liquid
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within internal sequence aa 90-139 ( YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA ) of Human CA7 (NP_005173).
  • Species Reactivity:
  • Human Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 97% PBS, 2% Sucrose
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Pre product:Rabbit Anti-CA7 Polyclonal Antibody-Advanced Biomart
  • Online Inquiry

    refresh