Cat#:FPA-5026P;Product Name:Rabbit Anti-C Reactive Protein Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide aa 140-190 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: KKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEI N ;Species Reactivity:Mouse, Human Predicted to work with: Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 1% BSA, 50% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Rabbit Anti-C Reactive Protein Polyclonal Antibody
Online Inquiry
Cat#:
FPA-5026P
Product Name:
Rabbit Anti-C Reactive Protein Polyclonal Antibody
Host Species:
Rabbit
Immunogen:
Synthetic peptide aa 140-190 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: KKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEI N