Rabbit Anti-C9orf89 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6068P

• Product Name:
• Rabbit Anti-C9orf89 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human C9orf89 aa 1-61 (N terminal). Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEK FRNPKASLRVR

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow

• Isotype:
• IgG

• Application:
• IHC-P, ICC/IF

• Storage Buffer:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.