Rabbit Anti-C9orf85 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6065P

• Product Name:
• Rabbit Anti-C9orf85 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 39-88 (KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCR P) of Mouse C9orf85 (NP_079699).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.