Rabbit Anti-C9orf78 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6062P

• Product Name:
• Rabbit Anti-C9orf78 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human C9orf78 aa 225-275. The exact sequence is proprietary. (NP_057604.1). Sequence: NRFYHEELNAPIRRNKEEPKARPLRVGDTEKPEPERSPPNRKRPANEKAT D

• Species Reactivity:
• Human Predicted to work with: Mouse, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.