Cat#:FPA-6015P;Product Name:Rabbit Anti-C9orf152 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N terminal aa 1-50 ( MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK ) of Human C9orf152 (NP_001374). ;Species Reactivity:Human Predicted to work with: Mouse, Cat, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within N terminal aa 1-50 ( MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK ) of Human C9orf152 (NP_001374).
Species Reactivity:
Human Predicted to work with: Mouse, Cat, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.