Rabbit Anti-C9orf152 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6015P

• Product Name:
• Rabbit Anti-C9orf152 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 1-50 ( MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK ) of Human C9orf152 (NP_001374).

• Species Reactivity:
• Human Predicted to work with: Mouse, Cat, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.