Rabbit Anti-C9orf123 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-6002P

• Product Name:
• Rabbit Anti-C9orf123 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human C9orf123 aa 59-108 (C terminal). The exact sequence is proprietary. Sequence: MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSIATWGIVVMADPKGKA

• Species Reactivity:
• Human Predicted to work with: Rabbit

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.