Cat#:FPA-5964P;Product Name:Rabbit Anti-C8ORF41 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human C8ORF41 aa 458-508 (C terminal). The exact sequence is proprietary. (NP_079391.2). Sequence: ATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVVNYIRKVQQVSEGAPYN ;Species Reactivity:Human;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human C8ORF41 aa 458-508 (C terminal). The exact sequence is proprietary. (NP_079391.2). Sequence: ATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVVNYIRKVQQVSEGAPYN