Rabbit Anti-C7orf55 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5939P

• Product Name:
• Rabbit Anti-C7orf55 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human C7orf55 aa 1-58 (N terminal). Sequence: MAALGSPSHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSE KLCRAQHE

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.