Cat#:FPA-5876P;Product Name:Rabbit Anti-C6orf163 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human C6orf163 aa 173-222 (C terminal). The exact sequence is proprietary. (NP_001010868.2) Sequence: RHIAQEAIQAQKSKAVEEIVNTGVTVIKDEKTSVARLMREKEHEMSILYG ;Species Reactivity:Human Predicted to work with: Rabbit;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human C6orf163 aa 173-222 (C terminal). The exact sequence is proprietary. (NP_001010868.2) Sequence: RHIAQEAIQAQKSKAVEEIVNTGVTVIKDEKTSVARLMREKEHEMSILYG
Species Reactivity:
Human Predicted to work with: Rabbit
Isotype:
IgG
Application:
WB
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.