Rabbit Anti-C6orf140 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46258P

• Product Name:
• Rabbit Anti-C6orf140 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human C6orf140 aa 203-252 (C terminal). The exact sequence is proprietary. NP_001010904 Sequence: WSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDD Database link: Q5SZD4 Run BLAST with Run BLAST with

• Species Reactivity:
• Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid