Cat#:FPA-5861P;Product Name:Rabbit Anti-C6orf134 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human C6orf134 aa 115-187. Sequence: EVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLL KFLNKHYNLETTVPQVNNFVIFE ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Pig;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;