Cat#:FPA-5810P;Product Name:Rabbit Anti-C4orf33 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within C terminal aa 127-176 ( PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF ) of Human C4orf33 (NP_001093253). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Synthetic peptide corresponding to a region within C terminal aa 127-176 ( PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF ) of Human C4orf33 (NP_001093253).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.