Cat#:FPA-5734P;Product Name:Rabbit Anti-C3IP1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human C3IP1 aa 68-117 (N terminal). The exact sequence is proprietary. (NP_067646) Sequence: EKGKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKG ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish;Isotype:IgG;Application:WB;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human C3IP1 aa 68-117 (N terminal). The exact sequence is proprietary. (NP_067646) Sequence: EKGKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKG
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
Isotype:
IgG
Application:
WB
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.