Rabbit Anti-C3IP1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5732P

• Product Name:
• Rabbit Anti-C3IP1 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human C3IP1 aa 70-120 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: GKPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVK Q

• Species Reactivity:
• Mouse, Rat, Human Predicted to work with: Cow

• Isotype:
• IgG

• Application:
• WB, Flow Cyt, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 0.01% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.