• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-c2orf73 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-46234P
  • Product Name:
  • Rabbit Anti-c2orf73 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fragment corresponding to Human c2orf73 aa 7-91. Sequence: KHQQHKIEDAAITYVSENEEIKHEEKPGKSIHHSKSHVGRGRIYYAKFIN TNARTYNEPFPYIDPKKGPEIQGDWWSHGKALEPV Database link: Q8N5S3 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • IHC-P
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-C2orf65 Polyclonal Antibody-FPA-46233P
  • Online Inquiry

    refresh