Rabbit Anti-C2orf42 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5680P

• Product Name:
• Rabbit Anti-C2orf42 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within C terminal aa 469-518 (LFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKVGNTSPDQKEPTPF I) of Human C2orf42, NP_060350

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.