Rabbit Anti-C2orf24 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5669P

• Product Name:
• Rabbit Anti-C2orf24 Polyclonal Antibody

• Formulation:
• Liquid

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human C2orf24 aa 91-140 (N terminal). The exact sequence is proprietary. (NP_056495) Sequence: ISPCAMMLALVYIERLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEE

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Orangutan

• Isotype:
• IgG

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.