Rabbit Anti-C21orf66 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5636P

• Product Name:
• Rabbit Anti-C21orf66 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human C21orf66 aa 225-275. The exact sequence is proprietary. (NP_057715.2). Sequence: IHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIV F

• Species Reactivity:
• Human Predicted to work with: Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 99% Tris buffered saline, 0.1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid