Rabbit Anti-C1orf67 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46222P

• Product Name:
• Rabbit Anti-C1orf67 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human C1orf67 aa 3107-3202 (N terminal). C1orf67 isoform 4 Sequence: ALNNYHEVQKVVGPKQIQVAEAQNVLKIARQRLAEKQRGLQLVEEHLLFL QAAYKDTVAEKQLLANRKTMASRRFQCASVLLTVLEDEKTRWQETI Database link: Q0VDD8-4 Run BLAST with Run BLAST w

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Clonality:
• Polyclonal

• Form:
• Liquid