Cat#:FPA-5503P;Product Name:Rabbit Anti-C1orf57 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human C1orf57 aa 32-95. Sequence: PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQY VVDLTSFEQLALPV ;Species Reactivity:Human Predicted to work with: Cow;Isotype:IgG;Application:ICC/IF, IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;