Rabbit Anti-C1orf19 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5469P

• Product Name:
• Rabbit Anti-C1orf19 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C-terminal aa 109-158 ( ASLSHNRIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFML ) of Mouse C1orf19 (NP_079953).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Guinea pig, Cow, Cat, Dog, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid