Rabbit Anti-C1orf177 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-5460P

• Product Name:
• Rabbit Anti-C1orf177 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal sequence aa 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN L) of Human C1orf177 (NP_689820)

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Cow

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid