Rabbit Anti-C19orf69 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-46211P

• Product Name:
• Rabbit Anti-C19orf69 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human C19orf69 aa 50-100. Sequence: SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKE E Database link: A6NGS2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituent: 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid