Cat#:FPA-5207P;Product Name:Rabbit Anti-C14orf130 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human C14orf130 aa 150-200. The exact sequence is proprietary. (NP_786924.2). Sequence: DEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQL A ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan;Isotype:IgG;Application:WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human C14orf130 aa 150-200. The exact sequence is proprietary. (NP_786924.2). Sequence: DEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQL A
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
USA: 1-862-686-3631
Fax: 1-323-978-5598
Email: