Rabbit Anti-BRN3B / POU4F2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-4861P

• Product Name:
• Rabbit Anti-BRN3B / POU4F2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human BRN3B/ POU4F2 aa 1-50 (N terminal). Sequence: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• ICC/IF, ELISA, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid