Rabbit Anti-Bovine Serum Albumin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-4731P

• Product Name:
• Rabbit Anti-Bovine Serum Albumin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Full length protein corresponding to Cow Bovine Serum Albumin aa 1-607. Antisera to bovine albumin was raised by repeated immunisations of rabbits with highly purified bovine albumin. Sequence: MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIA FSQYLQQCPF

• Species Reactivity:
• Cow

• Isotype:
• IgG

• Application:
• ELISA, IHC-Fr, WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid