Rabbit Anti-beta II Tubulin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-4349P

• Product Name:
• Rabbit Anti-beta II Tubulin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human beta II Tubulin aa 140-189 (N terminal). Sequence: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Sheep, Cow

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid