Rabbit Anti-beta Arrestin 1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-4270P

• Product Name:
• Rabbit Anti-beta Arrestin 1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human beta Arrestin 1 aa 368-418 (C terminal). The exact sequence is proprietary. NP_004032.2. Sequence: NETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNN R

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Gorilla, Common marmoset, Orangutan

• Isotype:
• IgG

• Application:
• IHC-P, WB, IP

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid