• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-beta Arrestin 1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-4270P
  • Product Name:
  • Rabbit Anti-beta Arrestin 1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human beta Arrestin 1 aa 368-418 (C terminal). The exact sequence is proprietary. NP_004032.2. Sequence: NETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNN R
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Gorilla, Common marmoset, Orangutan
  • Isotype:
  • IgG
  • Application:
  • IHC-P, WB, IP
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-beta Arrestin 1 Polyclonal Antibody-FPA-4269P
  • Online Inquiry

    refresh