Cat#:FPA-4253P;Product Name:Rabbit Anti-beta Amylase Polyclonal Antibody;Formulation:Lyophilised:Add 1mL of sterile distilled water. Spin down to remove insoluble particles.;Host Species:Rabbit ;Immunogen:Full length native protein (purified) corresponding to beta Amylase aa 2-499. (Isolated and purified from sweet potato). Sequence: APIPGVMPIGNYVSLYVMLPLGVVNADNVFPDKEKVEDELKQVKAGGCDG VMVDVWWGIIEAKGPKQYDWSAYRELFQLVKKCGLKIQAIMSFHQCGGNV GDAVFIPIPQWILQIGDKNPDI;Species Reactivity:Sweet potato;Isotype:IgG;Application:ICC, IHC-P, WB, Dot blot;Storage Buffer:pH: 7.20 Constituent: 100% PBS No preservative added. No foreign protein added.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.;

Home > Products > Primary Antibodies >

Rabbit Anti-beta Amylase Polyclonal Antibody Online Inquiry

Cat#:
FPA-4253P

Product Name:
Rabbit Anti-beta Amylase Polyclonal Antibody

Formulation:
Lyophilised:Add 1mL of sterile distilled water. Spin down to remove insoluble particles.

Host Species:
Rabbit

Immunogen:
Full length native protein (purified) corresponding to beta Amylase aa 2-499. (Isolated and purified from sweet potato). Sequence: APIPGVMPIGNYVSLYVMLPLGVVNADNVFPDKEKVEDELKQVKAGGCDG VMVDVWWGIIEAKGPKQYDWSAYRELFQLVKKCGLKIQAIMSFHQCGGNV GDAVFIPIPQWILQIGDKNPDI

Species Reactivity:
Sweet potato

Isotype:
IgG

Application:
ICC, IHC-P, WB, Dot blot

Storage Buffer:
pH: 7.20 Constituent: 100% PBS No preservative added. No foreign protein added.

Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.