Rabbit Anti-BAPX1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-3944P

• Product Name:
• Rabbit Anti-BAPX1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a region within the N terminal aa 2-51( AVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCC ) of Human BAPX1, NP_001180.

• Species Reactivity:
• Human Predicted to work with: Mouse, Rabbit, Chicken, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid