Cat#:FPA-3880P;Product Name:Rabbit Anti-Bag3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human Bag3 aa 300-350. The exact sequence is proprietary. (NP_004272.2). Sequence: DRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSK P ;Species Reactivity:Human;Isotype:IgG;Application:WB, IHC-P, ICC/IF, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human Bag3 aa 300-350. The exact sequence is proprietary. (NP_004272.2). Sequence: DRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSK P